PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF039800050CFD_t1
Common NameTAA_ctg0079b.00130.1, TRAES_3BF039800050CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 468aa    MW: 49623.3 Da    PI: 5.7623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF039800050CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.5e-15157202147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +g+W++eEd  l ++v + G ++W+ Iar ++ gR++k+c++rw + 
  TRAES3BF039800050CFD_t1 157 KGPWSPEEDAVLTNLVMRDGARNWTMIARGIP-GRSGKSCRLRWCNQ 202
                              79******************************.***********985 PP

2Myb_DNA-binding54.52.6e-17209253147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r+++T+eEd+ ++ a++ +G++ W++Ia+ +  gRt++ +k++w++ 
  TRAES3BF039800050CFD_t1 209 RKPFTEEEDQMIISAHAIHGNK-WASIAKLLV-GRTDNAIKNHWNST 253
                              789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.256152203IPR017930Myb domain
SuperFamilySSF466892.9E-29155250IPR009057Homeodomain-like
SMARTSM007173.3E-11156205IPR001005SANT/Myb domain
PfamPF002492.1E-13157202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-25158210IPR009057Homeodomain-like
CDDcd001671.58E-11159201No hitNo description
PROSITE profilePS5129426.427204258IPR017930Myb domain
SMARTSM007171.0E-16208256IPR001005SANT/Myb domain
PfamPF002491.4E-15209253IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-24211257IPR009057Homeodomain-like
CDDcd001671.41E-12211254No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MSSETAVSPQ PLSSSPPTAA VSAHSGPAPP ADEPEAPAPP QPPPHHASPL PAPSVSDETD  60
APTRPQPLPR HPIASSSSPS TAAGETQGPV HPPPQPQMHQ PASPSPSSAE PQTPVQPQPN  120
HSSPPLSGDD DDEDVVITGA LSGAGGAASS AADERVKGPW SPEEDAVLTN LVMRDGARNW  180
TMIARGIPGR SGKSCRLRWC NQLDPQLKRK PFTEEEDQMI ISAHAIHGNK WASIAKLLVG  240
RTDNAIKNHW NSTLRRRYCT GTRCTRSASA EQPMREMSRA VSEERWPLSG PSSFSVMEVK  300
EAPVQTVSES SAGALQIRDI NNCSTEAVDR SYPVRPVATV GAFRPYSLGP VQQMQMEMSS  360
STKFVPTIQA LTPEIAVSKF ADTTCFAADV PNKCGHGCCS AEEQPRNNSL LGPEFKEFID  420
HPPILSSSFA SLVSEISSIA WMNGGLQSSN SGNLVQSNPP APDKLGIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-391562576107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN5644270.0FN564427.1 Triticum aestivum chromosome 3B-specific BAC library, contig ctg0079b.
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232563.11e-171PREDICTED: uncharacterized protein LOC100827463
TrEMBLD8L9H60.0D8L9H6_WHEAT; Myb-like DNA-binding domain containing protein,expressed
STRINGMLOC_10322.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.13e-73myb domain protein 109
Publications ? help Back to Top
  1. Choulet F, et al.
    Megabase level sequencing reveals contrasted organization and evolution patterns of the wheat gene and transposable element spaces.
    Plant Cell, 2010. 22(6): p. 1686-701
    [PMID:20581307]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]